PGBD1 Rabbit Polyclonal Antibody

SKU TA341417

Rabbit Polyclonal Anti-PGBD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PGBD1 antibody: synthetic peptide directed towards the N terminal of human PGBD1. Synthetic peptide located within the following region: YEALPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQEICRLRFRHFC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 92 kDa
• Gene Name: piggyBac transposable element derived 1
• Database Link:
  NP_115896
  Q96JS3
• Background: The piggyBac family of proteins, found in diverse animals, are transposases related toThe transposase ofThe canonical piggyBac transposon fromThe moth, Trichoplusia ni.This family also includes genes in several genomes, including human, that appear to have been derived fromThe piggyBac transposons.This gene belongs toThe subfamily of piggyBac transposable element derived (PGBD) genes.The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families.This gene product is specifically expressed inThe brain, however, its exact function is not known. Alternative splicing results in multiple transcript variants encodingThe same protein. [provided by RefSeq, May 2010]
• Synonyms: dJ874C20.4; HUCEP-4; SCAND4
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Bovine: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors