SPATA5 Rabbit Polyclonal Antibody

SKU
TA340394
Rabbit Polyclonal Anti-SPATA5 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SPATA5 antibody: synthetic peptide directed towards the middle region of human SPATA5. Synthetic peptide located within the following region: ALLALEEDIQANLIMKRHFTQALSTVTPRIPESLRRFYEDYQEKSGLHTL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 98 kDa
Gene Name spermatogenesis associated 5
Database Link
Background SPATA5 may be involved in morphological and functional mitochondrial transformations during spermatogenesis.
Synonyms AFG2; EHLMRS; SPAF
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%
Reference Data
Write Your Own Review
You're reviewing:SPATA5 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.