SPATA5 Rabbit Polyclonal Antibody

CAT#: TA340394

Rabbit Polyclonal Anti-SPATA5 Antibody

Product Images

WB Suggested Anti-SPATA5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPATA5 antibody: synthetic peptide directed towards the middle region of human SPATA5. Synthetic peptide located within the following region: ALLALEEDIQANLIMKRHFTQALSTVTPRIPESLRRFYEDYQEKSGLHTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 98 kDa
• Gene Name: spermatogenesis associated 5
• Database Link:
  NP_660208
  Entrez Gene 166378 Human
  UniProt ID Q8NB90
• Background: SPATA5 may be involved in morphological and functional mitochondrial transformations during spermatogenesis.
• Synonyms: AFG2; EHLMRS; SPAF
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%