CCDC52 (SPICE1) Rabbit Polyclonal Antibody

SKU TA340364

Rabbit Polyclonal Anti-SPICE1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPICE1 antibody: synthetic peptide directed towards the N terminal of human SPICE1. Synthetic peptide located within the following region: TVTDLTVHRATPEDLVRRHEIHKSKNRALVHWELQEKALKRKWRKQKPET
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 96 kDa
• Gene Name: spindle and centriole associated protein 1
• Database Link:
  NP_653319
  Q8N0Z3
• Background: The specific function of SPICE1 is not yet known.
• Synonyms: CCDC52; SPICE
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Horse: 86%

Reference Data