FAM61B (LSM14B) Rabbit Polyclonal Antibody

CAT#: TA340356

Rabbit Polyclonal Anti-LSM14B Antibody

Product Images

Host: Rabbit; Target Name: LSM14B; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LSM14B antibody is: synthetic peptide directed towards the N-terminal region of HUMAN LSM14B. Synthetic peptide located within the following region: GPLAASSLLSQQYAASLGLEKLVSPPASAAASSPSSSPSPQPVSELDLSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: LSM family member 14B
• Database Link:
  NP_653304
  Entrez Gene 149986 Human
  UniProt ID Q9BX40
• Background: LSM14B may play a role in control of mRNA translation.
• Synonyms: bA11M20.3; C20orf40; FAM61B; FT005; LSM13; RAP55B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Zebrafish: 92%