C1orf51 (CIART) Rabbit Polyclonal Antibody

CAT#: TA340354

Rabbit Polyclonal Anti-C1orf51 Antibody

Product Images

WB Suggested Anti-C1orf51 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C1orf51 antibody: synthetic peptide directed towards the middle region of human C1orf51. Synthetic peptide located within the following region: GRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: circadian associated repressor of transcription
• Database Link:
  NP_653298
  Entrez Gene 148523 Human
  UniProt ID Q8N365
• Background: The function of this protein remains unknown.
• Synonyms: C1orf51; CHRONO; GM129
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Guinea pig: 93%; Bovine: 86%; Zebrafish: 85%