IQCD Rabbit Polyclonal Antibody

SKU
TA340295
Rabbit Polyclonal Anti-IQCD Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-IQCD antibody: synthetic peptide directed towards the N terminal of human IQCD. Synthetic peptide located within the following region: ALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 40 kDa
Gene Name IQ motif containing D
Database Link
Background IQCD contains 1 IQ domain. The function of the IQCD protein is not known.
Synonyms 4933433C09Rik; CFAP84; DRC10
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Write Your Own Review
You're reviewing:IQCD Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.