EMID2 (COL26A1) Rabbit Polyclonal Antibody

SKU
TA340272
Rabbit Polyclonal Anti-COL26A1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-COL26A1 antibody: synthetic peptide directed towards the C terminal of human COL26A1. Synthetic peptide located within the following region: GVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 45 kDa
Gene Name collagen type XXVI alpha 1
Database Link
Background COL26A1 contains 1 EMI domain and 2 collagen-like domains. The exact function of ZCCHC3 remains unknown.
Synonyms EMI6; EMID2; EMU2; SH2B
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 86%
Reference Data
Protein Families Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:EMID2 (COL26A1) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.