ANKS3 Rabbit Polyclonal Antibody

SKU TA340270

Rabbit Polyclonal Anti-ANKS3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANKS3 antibody: synthetic peptide directed towards the N terminal of human ANKS3. Synthetic peptide located within the following region: WHGLGTQVSGEELDVPLDLHTAASIGQYEVVKECVQRRELDLNKKNGGGW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 72 kDa
• Gene Name: ankyrin repeat and sterile alpha motif domain containing 3
• Database Link:
  NP_597707
  Q6ZW76
• Background: ANKS3 contains 1 SAM (sterile alpha motif) domain and 6 ANK repeats. The exact function of ANKS3 remains unknown.
• Synonyms: FLJ32345; FLJ32767; KIAA1977
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Dog: 86%; Pig: 79%; Guinea pig: 79%

Reference Data