ERI2 Rabbit Polyclonal Antibody

CAT#: TA340239

Rabbit Polyclonal Anti-EXOD1 Antibody

Product Images

WB Suggested Anti-EXOD1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EXOD1 antibody: synthetic peptide directed towards the N terminal of human EXOD1. Synthetic peptide located within the following region: GQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: ERI1 exoribonuclease family member 2
• Database Link:
  NP_542394
  Entrez Gene 112479 Human
  UniProt ID A8K979
• Background: EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.
• Synonyms: EXOD1; ZGRF5
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 92%; Zebrafish: 77%