AZIN2 Rabbit Polyclonal Antibody

SKU
TA340227
Rabbit Polyclonal Anti-ADC Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human, Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ADC antibody: synthetic peptide directed towards the middle region of human ADC. Synthetic peptide located within the following region: RHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGH
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 50 kDa
Gene Name antizyme inhibitor 2
Database Link
Background ADC decarboxylates L-arginine to agmatine. Truncated splice isoforms probably lack activity.
Synonyms ADC; AZI2; AZIB1; ODC-p; ODC1L; ODCp
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 86%; Dog: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Arginine and proline metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:AZIN2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.