Calcium binding protein P22 (CHP1) Rabbit Polyclonal Antibody
Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "Calcium binding protein P22"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 22 kDa |
Gene Name | calcineurin like EF-hand protein 1 |
Database Link | |
Background | This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. |
Synonyms | CHP; p22; p24; Sid470p; SLC9A1BP |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93% |
Reference Data | |
Protein Pathways | Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Axon guidance, B cell receptor signaling pathway, Calcium signaling pathway, Long-term potentiation, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Oocyte meiosis, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.