Calcium binding protein P22 (CHP1) Rabbit Polyclonal Antibody

CAT#: TA340165

Rabbit Polyclonal Anti-CHP1 Antibody

Product Images

WB Suggested Anti-CHP Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysateCHP1 is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Rabbit Anti-CHP1 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm and Membrane, moderate signal, low tissue distribution; Primary Antibody Concentration: 1: 100; Secondary Antibody: Donkey anti-Rabbit-Cy3;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: calcineurin like EF-hand protein 1
• Database Link:
  NP_009167
  Entrez Gene 11261 Human
  UniProt ID Q99653
• Background: This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity.
• Synonyms: CHP; p22; p24; Sid470p; SLC9A1BP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Pathways: Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Axon guidance, B cell receptor signaling pathway, Calcium signaling pathway, Long-term potentiation, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Oocyte meiosis, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway