TIMM44 Rabbit Polyclonal Antibody

CAT#: TA340102

Rabbit Polyclonal Anti-TIMM44 Antibody

Product Images

WB Suggested Anti-TIMM44 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TIMM44 antibody: synthetic peptide directed towards the N terminal of human TIMM44. Synthetic peptide located within the following region: MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: translocase of inner mitochondrial membrane 44
• Database Link:
  NP_006342
  Entrez Gene 10469 Human
  UniProt ID O43615
• Background: TIMM44 is the essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. It recruits mitochondrial HSP70 to driv
• Synonyms: TIM44
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 92%; Pig: 79%; Guinea pig: 79%; Dog: 75%