Dcaf7 Rabbit Polyclonal Antibody

SKU
TA340080
Rabbit Polyclonal Anti-Dcaf7 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Dcaf7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 38 kDa
Gene Name DDB1 and CUL4 associated factor 7
Database Link
Background Dcaf7 is involved in craniofacial development. It acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches. It associates with DIAPH1 and controls GLI1 transcriptional activity. It could be involved in skin development. It may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
Synonyms AN11; HAN11; SWAN-1; WDR68
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Write Your Own Review
You're reviewing:Dcaf7 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.