CRYBB3 Rabbit Polyclonal Antibody

SKU TA340043

Rabbit Polyclonal Anti-CRYBB3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CRYBB3 antibody: synthetic peptide directed towards the middle region of human CRYBB3. Synthetic peptide located within the following region: LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAING
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 24 kDa
• Gene Name: crystallin beta B3
• Database Link:
  NP_004067
  P26998
• Background: Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells l
• Synonyms: CATCN2; CRYB3; CTRCT22
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Sheep: 93%; Bovine: 93%; Zebrafish: 79%; Guinea pig: 79%

Reference Data