NHEDC1 (SLC9B1) Rabbit Polyclonal Antibody

SKU TA339997

Rabbit Polyclonal Anti-NHEDC1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NHEDC1 antibody: synthetic peptide directed towards the N terminal of human NHEDC1. Synthetic peptide located within the following region: MHTTESKNEHLEDENFQTSTTPQSLIDPNNTAHEETKTVLSDTEEIKPQT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 52 kDa
• Gene Name: solute carrier family 9 member B1
• Database Link:
  NP_001094344
  Q4ZJI4
• Background: NHEDC1 is a sodium/hydrogen exchanger and transmembrane protein. Highly conserved orthologs of this gene have been found in other mammalian species. The expression of NHEDC1 may be limited to testis.
• Synonyms: NHA1; NHEDC1
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane