C4orf33 Rabbit Polyclonal Antibody

CAT#: TA339995

Rabbit Polyclonal Anti-C4orf33 Antibody

Product Images

WB Suggested Anti-C4orf33 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C4orf33 antibody: synthetic peptide directed towards the C terminal of human C4orf33. Synthetic peptide located within the following region: PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: chromosome 4 open reading frame 33
• Database Link:
  NP_001093253
  Entrez Gene 132321 Human
  UniProt ID Q8N1A6
• Background: C4orf33 belongs to the UPF0462 family. The exact function of C4orf33 remains unknown.
• Synonyms: FLJ33703
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Guinea pig: 79%