LCN6 Rabbit Polyclonal Antibody

SKU
TA339883
Rabbit Polyclonal Anti-LCN6 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LCN6 antibody: synthetic peptide directed towards the middle region of human LCN6. Synthetic peptide located within the following region: LWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 18 kDa
Gene Name lipocalin 6
Database Link
Background LCN6 may play a role in male fertility.
Synonyms hLcn5; LCN5; UNQ643
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%
Reference Data
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:LCN6 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.