ZNF699 Rabbit Polyclonal Antibody

SKU TA339835

Rabbit Polyclonal Anti-ZNF699 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF699 antibody: synthetic peptide directed towards the N terminal of human ZNF699. Synthetic peptide located within the following region: EEDLQTVKRELIQGIFMGEHREGFETQLKTNESVASQDICGEKISNEQKI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 74 kDa
• Gene Name: zinc finger protein 699
• Database Link:
  NP_940937
  Q32M78
• Background: ZNF699 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
• Synonyms: hang
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rat: 86%; Dog: 77%

Reference Data