C1orf83 (TCEANC2) Rabbit Polyclonal Antibody

SKU TA339810

Rabbit Polyclonal Anti-TCEANC2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C1orf83 antibody: synthetic peptide directed towards the N terminal of human C1orf83. Synthetic peptide located within the following region: MDKFVIRTPRIQNSPQKKDSGGKVYKQATIESLKRVVVVEDIKRWKTMLE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 24 kDa
• Gene Name: transcription elongation factor A N-terminal and central domain containing 2
• Database Link:
  NP_694580
  Q96MN5
• Background: C1orf83 contains 1 TFIIS central domain and 1 TFIIS N-terminal domain. The exact functions of C1orf83 remain unknown..
• Synonyms: C1orf83
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 85%

Reference Data

• Protein Families: Transcription Factors