Zmat1 Rabbit Polyclonal Antibody

SKU
TA339773
Rabbit Polyclonal Anti-Zmat1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Zmat1 antibody is synthetic peptide directed towards the middle region of Mouse Zmat1. Synthetic peptide located within the following region: HNLPAESKTYDSFQDELEDYIKGQKARGLDPNTSFRRMSESYRYRDQRYR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 76 kDa
Gene Name zinc finger, matrin type 1
Database Link
Background The function of this protein remains unknown.
Synonyms KIAA1789; MGC176597; MGC176728
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 86%; Zebrafish: 82%
Reference Data
Write Your Own Review
You're reviewing:Zmat1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.