ZBTB46 Rabbit Polyclonal Antibody

SKU TA339759

Rabbit Polyclonal Anti-ZBTB46 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBTB46 antibody: synthetic peptide directed towards the N terminal of human ZBTB46. Synthetic peptide located within the following region: MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: zinc finger and BTB domain containing 46
• Database Link:
  NP_079500
  Q86UZ6
• Background: ZBTB46 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. ZBTB46 may be involved in transcriptional regulation.
• Synonyms: BTBD4; BZEL; dJ583P15.7; dJ583P15.8; RINZF; ZNF340
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Horse: 92%

Reference Data