ZNF816A (ZNF816) Rabbit Polyclonal Antibody

SKU TA339651

Rabbit Polyclonal Anti-ZNF816 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF816A antibody: synthetic peptide directed towards the N terminal of human ZNF816A. Synthetic peptide located within the following region: MEFSSTRHSITGEVIHTGTLQRHKSHHIGDFCFPEMKKDIHHFEFQWQEV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 76 kDa
• Gene Name: zinc finger protein 816
• Database Link:
  NP_001026835
  Q0VGE8
• Background: ZNF816A may be involved in transcriptional regulation.
• Synonyms: ZNF816A
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data