ABHD1 Rabbit Polyclonal Antibody

SKU TA339617

Rabbit Polyclonal Anti-ABHD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ABHD1 antibody: synthetic peptide directed towards the middle region of human ABHD1. Synthetic peptide located within the following region: GLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: abhydrolase domain containing 1
• Database Link:
  NP_115993
  Q96SE0
• Background: This gene is a member of the AB hydrolase superfamily and encodes a protein with an alpha/beta hydrolase fold. This domain is common to a number of hydrolytic enzymes of widely differing phylogenetic origins and catalytic functions.
• Synonyms: LABH1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 92%; Bovine: 86%

Reference Data

• Protein Families: Transmembrane