MLSTD2 (FAR1) Rabbit Polyclonal Antibody

SKU TA339603

Rabbit Polyclonal Anti-FAR1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MLSTD2 antibody: synthetic peptide directed towards the N terminal of human MLSTD2. Synthetic peptide located within the following region: LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 59 kDa
• Gene Name: fatty acyl-CoA reductase 1
• Database Link:
  NP_115604
  Q8WVX9
• Background: FAR1 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.
• Synonyms: MLSTD2; PFCRD; SDR10E1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane