KIRREL2 Rabbit Polyclonal Antibody

SKU TA339599

Rabbit Polyclonal Anti-KIRREL2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIRREL2 antibody: synthetic peptide directed towards the N terminal of human KIRREL2. Synthetic peptide located within the following region: WSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 67 kDa
• Gene Name: kin of IRRE like 2 (Drosophila)
• Database Link:
  NP_115499
  Q6UWL6
• Background: KIRREL2 is a single-pass type I membrane protein. KIRREL2 protein is a beta-cell-expressed Ig domain protein and may be involved in pancreas development or beta cell function.
• Synonyms: FILTRIN; NEPH3; NLG1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Transmembrane