ST6GALNAC5 Rabbit Polyclonal Antibody

CAT#: TA339573

Rabbit Polyclonal Anti-ST6GALNAC5 Antibody

Product Images

WB Suggested Anti-ST6GALNAC5 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ST6GALNAC5 antibody: synthetic peptide directed towards the middle region of human ST6GALNAC5. Synthetic peptide located within the following region: AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
• Database Link:
  NP_112227
  Entrez Gene 81849 Human
  UniProt ID Q9BVH7
• Background: ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]). [supplied by OMIM]
• Synonyms: SIAT7-E; SIAT7E; ST6GalNAcV
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycosphingolipid biosynthesis - ganglio series, Metabolic pathways