ST6GALNAC5 Rabbit Polyclonal Antibody

SKU TA339573

Rabbit Polyclonal Anti-ST6GALNAC5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ST6GALNAC5 antibody: synthetic peptide directed towards the middle region of human ST6GALNAC5. Synthetic peptide located within the following region: AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
• Database Link:
  NP_112227
  Q9BVH7
• Background: ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]). [supplied by OMIM]
• Synonyms: SIAT7-E; SIAT7E; ST6GalNAcV
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycosphingolipid biosynthesis - ganglio series, Metabolic pathways