SPACA1 Rabbit Polyclonal Antibody

SKU TA339572

Rabbit Polyclonal Anti-SPACA1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPACA1 antibody: synthetic peptide directed towards the N terminal of human SPACA1. Synthetic peptide located within the following region: TENNDSETAENYAPPETEDVSNRNVVKEVEFGMCTVTCGIGVREVILTNG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: sperm acrosome associated 1
• Database Link:
  NP_112222
  Q9HBV2
• Background: The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from infertile males. Furthermore, antibodies generated against the recombinant protein block in vitro fertilization. This protein localizes to the acrosomal membrane of spermatids and mature spermatozoa where it is thought to play a role in acrosomal morphogenesis and in sperm-egg binding and fusion, respectively.
• Synonyms: SAMP32
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane