AMN Rabbit Polyclonal Antibody

SKU TA339571

Rabbit Polyclonal Anti-AMN Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AMN antibody: synthetic peptide directed towards the N terminal of human AMN. Synthetic peptide located within the following region: NWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: amnion associated transmembrane protein
• Database Link:
  NP_112205
  Q9BXJ7
• Background: The protein encoded by this gene is a type I transmembrane protein. It is thought to modulate bone morphogenetic protein (BMP) receptor function by serving as an accessory or coreceptor, and thus facilitates or hinders BMP binding. It is known that the mouse AMN gene is expressed in the extraembryonic visceral endoderm layer during gastrulation, but it is found to be mutated in amnionless mouse. The encoded protein has sequence similarity to short gastrulation (Sog) and procollagen IIA proteins in Drosophila.
• Synonyms: amnionless; PRO1028
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome, Transmembrane