H13 Rabbit Polyclonal Antibody

CAT#: TA339562

Rabbit Polyclonal Anti-H13 Antibody

Product Images

WB Suggested Anti-H13 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-H13 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: histocompatibility 13
• Database Link:
  NP_034506
  Entrez Gene 14950 Mouse
  UniProt ID Q9D8V0
• Background: H13 catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. It is required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides. Involved in the intramembrane cleavage of the integral membrane protein PSEN1 By similarity. It may play a role in graft rejection.
• Synonyms: 1200006O09Rik; 4930443L17Rik; 5031424B04Rik; AV020344; H-13; Hm13; PSL3; Spp
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 92%