MPIG6B Rabbit Polyclonal Antibody

CAT#: TA339555

Rabbit Polyclonal Anti-C6orf25 Antibody

Product Images

WB Suggested Anti-C6orf25 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C6orf25 antibody: synthetic peptide directed towards the N terminal of human C6orf25. Synthetic peptide located within the following region: AVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: chromosome 6 open reading frame 25
• Database Link:
  NP_079536
  Entrez Gene 80739 Human
  UniProt ID O95866
• Background: The exact function of C6orf25 remains unknown.This gene is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: G6b; NG31
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane