OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SUN1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA339546
Rabbit Polyclonal Anti-SUN1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY427327 Transient overexpression lysate of Sad1 and UNC84 domain containing 1 (SUN1), transcript variant 1 (as WB positive control) 100 ug
$665.00

View other "SUN1 or NM_025154" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB, IF
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-UNC84A antibody: synthetic peptide directed towards the N terminal of human UNC84A. Synthetic peptide located within the following region: QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 78 kDa
Gene Name Sad1 and UNC84 domain containing 1
Database Link
Background UNC84A is a a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration.This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described; however, the full-length nature of some of these variants has not been determined.
Synonyms UNC84A
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Guinea pig: 93%; Horse: 86%; Rabbit: 75%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products