ZNF490 Rabbit Polyclonal Antibody

SKU
TA339519
Rabbit Polyclonal Anti-ZNF490 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF490 antibody: synthetic peptide directed towards the N terminal of human ZNF490. Synthetic peptide located within the following region: DEHKNQGRNLRSPMVEALCENKEDCPCGKSTSQIPDLNTNLETPTGLKPC
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 61 kDa
Gene Name zinc finger protein 490
Database Link
Background May be involved in transcriptional regulation.
Synonyms KIAA1198
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZNF490 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.