ZNF223 Rabbit Polyclonal Antibody

SKU TA339460

Rabbit Polyclonal Anti-ZNF223 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF223 antibody: synthetic peptide directed towards the N terminal of human ZNF223. Synthetic peptide located within the following region: HEGWSCQQIWEEIASDLTRPQDSTIKSSQFFEQGDAHSQVEEGISIMHTG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: zinc finger protein 223
• Database Link:
  NP_037493
  Q9UK11
• Background: This gene encodes a protein containing a Kruppel-associated box domain and multiple zinc finger domains. The function of this protein has yet to be determined. [provided by RefSeq, Mar 2014]
• Synonyms: Homo sapiens zinc finger protein 223; KRAB A domain; zinc finger protein 223; Zinc finger protein ZNF223
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors