OXA1L Rabbit Polyclonal Antibody

SKU TA339438

Rabbit Polyclonal Anti-OXA1L Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-OXA1L antibody is: synthetic peptide directed towards the C-terminal region of Human OXA1L. Synthetic peptide located within the following region: NAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: OXA1L, mitochondrial inner membrane protein
• Database Link:
  NP_005006
  Q15070
• Background: OXA1L is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. It is essential for the activity and assembly of cytochrome oxidase and is required for the correct biogenesis of ATP synthase and complex I in mitochondria.
• Synonyms: OXA1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Protein export