B4galt5 Rabbit Polyclonal Antibody

SKU TA339433

Rabbit Polyclonal Anti-B4galt5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-B4galt5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5
• Database Link:
  NP_062809
  Q9JMK0
• Background: Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids.
• Synonyms: B4Gal-T5; BETA4-GALT-IV; beta4Gal-T5; beta4GalT-V; gt-V; MGC138470
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 85%

Reference Data