Calmegin (CLGN) Rabbit Polyclonal Antibody

SKU TA339408

Rabbit Polyclonal Anti-CLGN Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLGN antibody: synthetic peptide directed towards the N terminal of human CLGN. Synthetic peptide located within the following region: YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 70 kDa
• Gene Name: calmegin
• Database Link:
  NP_004353
  O14967
• Background: Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneisis and infertility. [provided by RefSeq, Jul 2008]
• Synonyms: calmegin
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane