TMPRSS11D Rabbit Polyclonal Antibody

SKU TA339400

Rabbit Polyclonal Anti-TMPRSS11D Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMPRSS11D antibody: synthetic peptide directed towards the N terminal of human TMPRSS11D. Synthetic peptide located within the following region: RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: transmembrane protease, serine 11D
• Database Link:
  NP_004253
  O60235
• Background: This gene encodes a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions. [provided by RefSeq, Jul 2008]
• Synonyms: HAT
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 79%; Horse: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein, Transmembrane