PIGQ Rabbit Polyclonal Antibody

CAT#: TA339399

Rabbit Polyclonal Anti-PIGQ Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human phosphatidylinositol glycan anchor biosynthesis, class Q (PIGQ), transcript variant 1, 20 µg
    • 20 ug

USD 867.00


Transient overexpression lysate of phosphatidylinositol glycan anchor biosynthesis, class Q (PIGQ), transcript variant 1
    • 100 ug

USD 436.00

Other products for "PIGQ"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PIGQ antibody: synthetic peptide directed towards the N terminal of human PIGQ. Synthetic peptide located within the following region: PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 65 kDa
Gene Name phosphatidylinositol glycan anchor biosynthesis class Q
Background This gene is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2012]
Synonyms c407A10.1; GPI1
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Rat: 86%; Pig: 79%; Mouse: 79%; Guinea pig: 79%
Reference Data
Protein Families Transmembrane
Protein Pathways Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.