PIGQ Rabbit Polyclonal Antibody

SKU
TA339398
Rabbit Polyclonal Anti-PIGQ Antibody
$585.00
5 Days*
Specifications
Product Data
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PIGQ antibody: synthetic peptide directed towards the N terminal of human PIGQ. Synthetic peptide located within the following region: VLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 84 kDa
Gene Name phosphatidylinositol glycan anchor biosynthesis class Q
Database Link
Background This gene is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2012]
Synonyms c407A10.1; GPI1
Note Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Bovine: 92%; Horse: 85%; Rabbit: 85%; Mouse: 83%; Guinea pig: 83%
Reference Data
Protein Families Transmembrane
Protein Pathways Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways
Write Your Own Review
You're reviewing:PIGQ Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.