KIAA0020 (PUM3) Rabbit Polyclonal Antibody

SKU TA339320

Rabbit Polyclonal Anti-KIAA0020 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIAA0020 antibody: synthetic peptide directed towards the N terminal of human KIAA0020. Synthetic peptide located within the following region: EVKGKKQFTGKSTKTAQEKNRFHKNSDSGSSKTFPTRKVAKEGGPKVTSR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 73 kDa
• Gene Name: pumilio RNA binding family member 3
• Database Link:
  NP_055693
  Q15397
• Background: KIAA0020 contains 6 pumilio repeats and 1PUM-HD domain. The function remains unknown.
• Synonyms: HA-8; HLA-HA8; KIAA0020; PEN; PUF-A; PUF6; XTP5
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Pig: 86%; Rabbit: 86%; Bovine: 79%

Reference Data