CNAP1 (NCAPD2) Rabbit Polyclonal Antibody

SKU TA339319

Rabbit Polyclonal Anti-NCAPD2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NCAPD2 antibody: synthetic peptide directed towards the C terminal of human NCAPD2. Synthetic peptide located within the following region: KAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 157 kDa
• Gene Name: non-SMC condensin I complex subunit D2
• Database Link:
  NP_055680
  Q15021
• Background: NCAPD2 is the regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. NCAPD2 may target the condensin complex to DNA via its C-terminal domain.
• Synonyms: CAP-D2; CNAP1; hCAP-D2
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 92%; Rabbit: 92%; Dog: 79%

Reference Data