KLHDC5 (KLHL42) Rabbit Polyclonal Antibody

SKU
TA339242
Rabbit Polyclonal Anti-KLHL42
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KLHDC5 antibody: synthetic peptide directed towards the middle region of human KLHDC5. Synthetic peptide located within the following region: IVGGCLHELGPNRRSSQSEDMLTVQSYNTVTRQWLYLKENTSKSGLNLTC
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 57 kDa
Gene Name kelch like family member 42
Database Link
Background KLHL42 contains 1 BTB (POZ) domain and 6 Kelch repeats. It is phosphorylated upon DNA damage, probably by ATM or ATR. The exact functions of KLHL42 remain unknown.
Synonyms Ctb9; KLHDC5
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Bovine: 86%; Rabbit: 86%
Reference Data
Write Your Own Review
You're reviewing:KLHDC5 (KLHL42) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.