KLHDC5 (KLHL42) Rabbit Polyclonal Antibody

CAT#: TA339242

Reviews ()
Write a review

Rabbit Polyclonal Anti-KLHL42

 Product Datasheet for 'TA339242'

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KLHDC5 antibody: synthetic peptide directed towards the middle region of human KLHDC5. Synthetic peptide located within the following region: IVGGCLHELGPNRRSSQSEDMLTVQSYNTVTRQWLYLKENTSKSGLNLTC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml
Purification Protein A purified
Predicted Protein Size 57 kDa
Gene Name kelch like family member 42
Background KLHL42 contains 1 BTB (POZ) domain and 6 Kelch repeats. It is phosphorylated upon DNA damage, probably by ATM or ATR. The exact functions of KLHL42 remain unknown.
Synonyms Ctb9; KLHDC5
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Bovine: 86%; Rabbit: 86%
Reference Data
Other products for "KLHL42"
Frequently bought together (2)
Transient overexpression lysate of kelch domain containing 5 (KLHDC5)
    • 100 ug

USD 315.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
BOGO Free lysates
68 Mouse Clones