PTIP (PAXIP1) Rabbit Polyclonal Antibody

SKU TA339229

Rabbit Polyclonal Anti-PAXIP1

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PAXIP1 antibody: synthetic peptide directed towards the N terminal of human PAXIP1. Synthetic peptide located within the following region: MFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 74 kDa
• Gene Name: PAX interacting protein 1
• Database Link:
  NP_031375
  Q6ZW49
• Background: PAXIP1 functions as a key component of the DNA damage response, and phosphoserine or phosphothreonine-specific binding modules. PAXIP1 recognizes substrates phosphorylated by the kinases ataxia telangiectasia-mutated (ATM), ataxia telangiectasia and RAD3-related (ATR) in response to gamma irradiation. It may play a role in PAX2-dependent transcriptional regulation. PAXIP1 plays a role in early development, most probably in cell proliferation.
• Synonyms: CAGF28; CAGF29; PACIP1; PAXIP1L; PTIP; TNRC2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data