PHF22 (INTS12) Rabbit Polyclonal Antibody

SKU TA339150

Rabbit Polyclonal Anti-INTS12

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-INTS12 antibody: synthetic peptide directed towards the N terminal of human INTS12. Synthetic peptide located within the following region: DESLARGIDSSYRPSQKDVEPPKISSTKNISIKQEPKISSSLPSGNNNGK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: integrator complex subunit 12
• Database Link:
  NP_065128
  Q96CB8
• Background: INTS12 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1) and U2 (RNU2).INTS12 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (Baillat et al., 2005 [PubMed 16239144]). [supplied by OMIM]
• Synonyms: INT12; PHF22; SBBI22
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors