MAGEA9 Rabbit Polyclonal Antibody

SKU
TA339109
Rabbit Polyclonal Anti-MAGEA9 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MAGEA9 antibody: synthetic peptide directed towards the middle region of human MAGEA9. Synthetic peptide located within the following region: ALKLKVAELVHFLLHKYRVKEPVTKAEMLESVIKNYKRYFPVIFGKASEF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 35 kDa
Gene Name MAGE family member A9
Database Link
Background This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq, Jul 2008]
Synonyms CT1.9; MAGE9
Note Immunogen Sequence Homology: Human: 100%; Rat: 85%; Rabbit: 85%; Dog: 79%; Pig: 79%; Horse: 79%; Yeast: 77%; Bovine: 77%
Reference Data
Write Your Own Review
You're reviewing:MAGEA9 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.