ZNF133 Rabbit Polyclonal Antibody

SKU TA339076

Rabbit Polyclonal Anti-ZNF133 Antibody

Product Data

• Application: IF, WB
• Recommended Dilution: WB, IF
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF133 antibody: synthetic peptide directed towards the N terminal of human ZNF133. Synthetic peptide located within the following region: LRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 73 kDa
• Gene Name: zinc finger protein 133
• Database Link:
  NP_003425
  P52736
• Background: May be involved in transcriptional regulation as a repressor.
• Synonyms: pHZ-13; pHZ-66; ZNF150
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 93%; Horse: 92%; Mouse: 83%

Reference Data

• Protein Families: Transcription Factors