SERCA3 (ATP2A3) Rabbit Polyclonal Antibody

SKU TA339001

Rabbit Polyclonal Anti-ATP2A3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATP2A3 antibody: synthetic peptide directed towards the middle region of human ATP2A3. Synthetic peptide located within the following region: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 109 kDa
• Gene Name: ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3
• Database Link:
  NP_005164
  Q93084
• Background: This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Synonyms: SERCA3
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Horse: 86%; Pig: 79%; Rat: 79%; Bovine: 79%; Guinea pig: 79%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Alzheimer's disease, Calcium signaling pathway