MTHFD2 Rabbit Polyclonal Antibody

SKU
TA338981
Rabbit Polyclonal Anti-MTHFD2 Antibody
$525.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 35 kDa
Gene Name methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase
Database Link
Background This gene encodes a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD. Alternative splicing results in two different transcripts, one protein-coding and the other not protein-coding. This gene has a pseudogene on chromosome 7. [provided by RefSeq, Mar 2009]
Synonyms NMDMC
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 92%; Zebrafish: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Glyoxylate and dicarboxylate metabolism, Metabolic pathways, One carbon pool by folate
Write Your Own Review
You're reviewing:MTHFD2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.