KRTAP24-1 Rabbit Polyclonal Antibody

CAT#: TA338962

Reviews ()
Write a review

Rabbit Polyclonal Anti-KRTAP24-1 Antibody



USD 539.00


Availability*
5 Days

Size
    • 100 ul


Product images

Other products for "KRTAP24-1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KRTAP24-1 antibody: synthetic peptide directed towards the middle region of human KRTAP24-1. Synthetic peptide located within the following region: LVRNYHYSSYRPTSCRPLSYLSRSFRSLSYIPSTFPPLRYLCSGSRPLKC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 28 kDa
Gene Name keratin associated protein 24-1
Background In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
Synonyms KAP24.1
Note Immunogen Sequence Homology: Human: 100%; Horse: 86%; Rat: 85%; Dog: 79%; Sheep: 77%; Bovine: 77%
Reference Data
Frequently bought together (2)
Transient overexpression lysate of keratin associated protein 24-1 (KRTAP24-1)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.