KRTAP24-1 Rabbit Polyclonal Antibody

CAT#: TA338962

Rabbit Polyclonal Anti-KRTAP24-1 Antibody

Product Images

WB Suggested Anti-KRTAP24-1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KRTAP24-1 antibody: synthetic peptide directed towards the middle region of human KRTAP24-1. Synthetic peptide located within the following region: LVRNYHYSSYRPTSCRPLSYLSRSFRSLSYIPSTFPPLRYLCSGSRPLKC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: keratin associated protein 24-1
• Database Link:
  NP_001078924
  Entrez Gene 643803 Human
  UniProt ID Q3LI83
• Background: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
• Synonyms: KAP24.1
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Rat: 85%; Dog: 79%; Sheep: 77%; Bovine: 77%