KRTAP11-1 Rabbit Polyclonal Antibody

SKU TA338959

Rabbit Polyclonal Anti-KRTAP11-1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KRTAP11-1 antibody: synthetic peptide directed towards the N terminal of human KRTAP11-1. Synthetic peptide located within the following region: SFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 17 kDa
• Gene Name: keratin associated protein 11-1
• Database Link:
  NP_787054
  Q8IUC1
• Background: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
• Synonyms: HACL-1; HACL1; KAP11.1
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data